PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cotton_A_14653_BGI-A2_v1.0
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family ZF-HD
Protein Properties Length: 325aa    MW: 36043.2 Da    PI: 9.1874
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cotton_A_14653_BGI-A2_v1.0genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer107.86.4e-34115169459
                 ZF-HD_dimer   4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                                 +rYkeClkNhAas+Ggh+vDGCgEfmps geegt++alkCaAC+CHR+FHR+e + 
  Cotton_A_14653_BGI-A2_v1.0 115 IRYKECLKNHAASMGGHVVDGCGEFMPS-GEEGTPEALKCAACECHRSFHRKEING 169
                                 79*************************9.999********************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257741.0E-21113168IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.5E-31115167IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.7E-31116167IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.418117166IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466896.48E-20245319IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-29246319IPR009057Homeodomain-like
PROSITE profilePS500718.762256320IPR001356Homeobox domain
TIGRFAMsTIGR015651.3E-27258315IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MELRGQDNKE MGMPSSFSYK NQLNKDSYSS APVNSATGER RRDRTVRGDP NLPQTLDDPL  60
SVPNPRRDPD PDPVSASTAT TGEIAAAADS RSPPTPEPQP VAGPTSATIS FTPLIRYKEC  120
LKNHAASMGG HVVDGCGEFM PSGEEGTPEA LKCAACECHR SFHRKEINGE SQYAPSSYYY  180
TNNNNNTRRN AVRPPRRATP LHHQRFSLGL SASPPAMSVA PLMMSFGGGG PAESSSEDLH  240
VFHFSEGGQQ PSHPHSSKKR FRTKFSQEQK KKMMEFADKL GWKIQKQDDE QVQQFCDQVG  300
VKRQVLKVWM HNNKQAMKRT NVRDI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A8e-242573141673ZF-HD homeobox family protein
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1257271KKRFRTKFSQEQKKK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00268DAPTransfer from AT2G18350Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6149440.0JX614944.1 Gossypium hirsutum clone NBRI_GE58680 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012491647.10.0PREDICTED: zinc-finger homeodomain protein 6-like
SwissprotQ9ZPW71e-70ZHD6_ARATH; Zinc-finger homeodomain protein 6
TrEMBLA0A0D2PCF50.0A0A0D2PCF5_G
STRINGPOPTR_0005s12420.16e-94(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65152543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18350.18e-70homeobox protein 24